PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 195aa    MW: 21819.4 Da    PI: 8.3273
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0136genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v+++G  +W++I+r++  gR++k+c++rw + 
      Gh_A06G0136 19 KGPWSAEEDRVLTRLVERYGAWNWSLISRYIK-GRSGKSCRLRWCNQ 64
                     79*****************************9.***********985 PP

2Myb_DNA-binding49.69.1e-1673115347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+ Ede ++ a+  +G++ W+tIa+ ++ gRt++ +k++w++ 
      Gh_A06G0136  73 PFTKAEDETILAAHCVYGNR-WATIAKLLP-GRTDNAVKNHWNST 115
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9021465IPR017930Myb domain
SuperFamilySSF466895.03E-3116112IPR009057Homeodomain-like
SMARTSM007171.3E-131867IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-242072IPR009057Homeodomain-like
CDDcd001672.70E-122163No hitNo description
PfamPF139211.0E-162280No hitNo description
PROSITE profilePS5129423.76366120IPR017930Myb domain
SMARTSM007172.5E-1370118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2273120IPR009057Homeodomain-like
CDDcd001676.54E-1073116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MNGCSSSSDT SSSESSRIKG PWSAEEDRVL TRLVERYGAW NWSLISRYIK GRSGKSCRLR  60
WCNQLSPDVE HRPFTKAEDE TILAAHCVYG NRWATIAKLL PGRTDNAVKN HWNSTLKRRI  120
REQKTEQKGS VVVDEEEVLT ALTLAPPGSG GGLTVEGRRE EEVTAEFWDA MKGVIASEVR  180
DYMSSTLSSN TSKLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-42181206108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450372.11e-123PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-53MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2R0I61e-123A0A0D2R0I6_G
STRINGVIT_18s0001g11170.t018e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145531122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-54myb domain protein r1